• 전문가 요청 쿠폰 이벤트
  • 통합검색(110)
  • 리포트(100)
  • 시험자료(6)
  • 논문(2)
  • 방송통신대(1)
  • ppt테마(1)
판매자 표지는 다운로드시 포함되지 않습니다.

"Body-surface temperature" 검색결과 1-20 / 110건

  • 환경온도가 비육돈의 호흡수, 직장 온도 및 체표면 온도에 미치는 영향 (Effect of environmental temperature on respiration rate, rectal temperature and body-surface temperatures in finishing pigs)
    한국산학기술학회 천시내, 박규현, 최희철, 김종복, 권경석, 이준엽, 우샘이, 양가영, 전중환
    논문 | 8페이지 | 무료 | 등록일 2025.04.12 | 수정일 2025.05.09
  • 24. 별의 표면 온도와 크기(Surface temperature and size of star)
    스펙트럼1. 별의 표면온도 (surface temperature of star) 키르히호프 법칙 (Kirchhoff’s law) - 연속 스펙트럼 , 흡수 스펙트럼 , 방출 스펙트럼 ... 시킬 때 나타남 1. 별의 표면온도 (surface temperature of star)방출선 (Emission band ) - 열에너지나 빛에너지를 받은 전자가 들떠서 높은 에너지 ... (surface temperature of star)흡수선 (Absorption band ) - 연속스펙트럼을 가지는 빛을 차가운 기체에 통과시킬 때 → 기체가 특정 파장의 빛
    Non-Ai HUMAN
    | 리포트 | 13페이지 | 3,900원 | 등록일 2021.09.04
  • 우주 탬플릿
    light, is about Five Billion years old.The sun’s surface, the photosphere has temperature of about 5 ... a Meteorite . A small body that would become a meteor if it entered the earth’s surface us known as ... :mercury Mercury is the closest planet to the sun. It is a small, rocky planet. Its surface has been
    ppt테마 | 35페이지 | 1,500원 | 등록일 2024.01.17
  • 판매자 표지 자료 표지
    대학영어1공통 아래의 두 가지 과제A B를 모두 작성 교재 Unit 1과 멀티강의 1 2강에서 선택한 10개의 각 키워드와 관련 교재 외의 자료00
    : "Climate change refers to long-term shifts in temperatures and weather patterns."? United Nations한글 해석 ... attenuated or inactivated forms of the microbe, its toxins, or one of its surface proteins.일반적으로 백신 ... .한글 해석: 시스템, 네트워크, 프로그램을 디지털 공격으로부터 보호하는 활동.8) E-commerceDefinition: Buying and selling goods and s
    방송통신대 | 10페이지 | 5,000원 | 등록일 2025.09.18 | 수정일 2025.10.01
  • 도시 열섬 영어 에세이 (전문학술영어 에세이)
    increasing the green rate of the entire surface. An example is the use of light-colored packaging ... , where the average temperature of the city is higher than that of the suburbs, can reduce the city's ... more solar heat than natural objects such as forests and water bodies. These artificial structures
    Non-Ai HUMAN
    | 리포트 | 3페이지 | 1,000원 | 등록일 2021.06.22
  • 판매자 표지 자료 표지
    감염위험성 정의, 간호과정 (영어)
    microbes, invade the body and cause disease by proliferating on the surface of mucous membranes or in ... Assessment RationaleNursing Assessment Elevated temperature. Cloudy, turbid, foul-smelling urine with ... determined by pathogens identified. . Temperature of up to 38º C 48 hours post-op is usually related to
    리포트 | 25페이지 | 3,000원 | 등록일 2023.01.24
  • 판매자 표지 자료 표지
    pre report-Abbe굴절계를 이용한 굴절률 측정
    the light passes by the boundary surface, the situation that the light direction of progress changes ... type of reflection surface not to make the difference of optical axis between the optical lens and ... ompd, but the upper surface of the bottom surface is made of fine powder. The surface with powder s
    Non-Ai HUMAN
    | 리포트 | 3페이지 | 2,500원 | 등록일 2022.06.10
  • 기본간호학 의학용어 19장 체온유지
    으로 구분됨21core temperature심부체온복강, 골반강과 같은 인체 심부 조직의 온도비교적 일정함22surface temperature표면체온피부, 피하조직, 지방의 온도환경 ... 하지 못하거나 열 소실이 제대로 되지 않아 체온이 계속 상승하여 지속되고 있는 상태3set-point기준점신체가 설정해 놓아서 체온조절기전이 유지하려고 하는 온도4cold ... 거나 차가운 감각을 받아들임17effector system효과체계체내에서 설정한 기준점보다 체온이 높거나 낮을 때 활성화함18cold-sensitive receptor냉민감수용기신호
    Non-Ai HUMAN
    | 리포트 | 4페이지 | 1,000원 | 등록일 2021.10.30 | 수정일 2022.10.25
  • 포유자돈의 합사가 모돈과 자돈의 체표면 온도 변화에 미치는 영향 (Effect of mixing of suckling piglets on change of body surface temperature in sows and piglets)
    한국산학기술학회 김두완, 김영화, 김광식, 김기현
    논문 | 6페이지 | 무료 | 등록일 2025.04.12 | 수정일 2025.05.09
  • 항공기 날개골의 종류 및 항공기에 작용하는 힘의 종류를 그림과 함께 특징에 대해 영문으로 간단히 소개하시오
    wave on the surface immediately makes pressure, temperature and density of air rise. Form drag is a ... ean Camber : An imaginary line which is equidistance from upper and lower surface of an airfoil s ... upper and lower surfaces. Camber directly affects whether the airfoil get more or less lift force.The
    Non-Ai HUMAN
    | 리포트 | 5페이지 | 1,000원 | 등록일 2021.04.30
  • 복사실험 예비보고서
    from a black body - surroundings absolute zero" 3) Wien's Law, 때때로 Wien의 변위 법 (Wien 's Displacement ... 열 유체 공학 실험복사실험 예비보고서목차black bodyStefan-Boltzmann lawWien’s displacement ... lawemissivityabsorptivityreflectivitytransmissivitygray surfaceworking distance참고문헌Black body주로 적외선 영역에서 전자파의 형태로 방사선을 통한 열 전달
    Non-Ai HUMAN
    | 리포트 | 5페이지 | 2,500원 | 등록일 2021.06.29
  • 판매자 표지 자료 표지
    신규, 실습전 필수 의학용어
    APAnterior-posterior전후방의14aq.water(aqua)물15BBbed bath침상목욕16BBTbasal body temperature기초체온17BCback care ... 전23BSAbody surface area체표면적24BTbed time취침시간25BWbody weight체중26body water체액NoAbbreviationFull ... olitis궤양성 대장염160VHViral hepatitis바이러스성 간염161Z-EZollinger-Ellison(syndrome)졸리-엘리슨 증후군근골격계162AEAbove
    리포트 | 8페이지 | 1,500원 | 등록일 2025.04.10
  • 판매자 표지 자료 표지
    아토피 피부염 (Atopic Dermatitis) 아동간호학에 케이스 스터디(문헌고찰 및 진단 6개)
    습니다.? 영유아기(Infantile phase): 주로 얼굴(Face), 두피(Scalp), 팔과 다리의 신측부(Extensor surfaces)에 나타납니다.? 어린이기 ... 삼출물(Oozing)을 동반할 수 있습니다.? 태선화 (Lichenification): 만성화된 경우 피부가 두꺼워지고 거칠어지는 현상이 나타납니다.2. 연령별 증상 (Age-s ... (Extensor surfaces)에 붉은 발진이 나타납니다.? 젖병 피부염 (Milk crust): 유아의 얼굴과 두피에 나타나는 지루성 피부염의 일종으로, 아토피 피부염과 함께 발생할 수
    리포트 | 13페이지 | 4,000원 | 등록일 2024.05.24
  • 단국대학교 기계공학과 기계공학실험3 열전도계수측정실험, 확장표면열전달실험 보고서 최종 성적 A+
    확장표면 열전달실험 결과표Extended surface heat transferHeater Power(W)Temperature gradient(T _{1} CDOTST _{7})[ETK ... 함으로써 발 식을q _{r}에 대해서 다음과 같이 정리할 수 있다.q _{r} = {2 pi Lk(T _{s,1} -T _{s,2} )} over {ln(r _{2} /r _{1 ... .2} )}#k _{Copper,20W} & =- {20 TIMES0.03} over {{pi(0.03) ^{2}} over {4} (301.4-302.5)}#k _{Copper
    Non-Ai HUMAN
    | 리포트 | 11페이지 | 6,000원 | 등록일 2022.10.11
  • 판매자 표지 자료 표지
    기본간호학 17장활동과운동,19장체온유지 의학용어정리
    과 같이 의식적으로 체온을 조절하기 위한 적절한 행동을 취한다.21body temperature체온인체의 열생산과 열소실의 균형을 반영심부체온과 표면체온으로 구분22surface ... emi-sitting position파울러씨 체위=반좌위침상머리 부분을 45도내지 60도 올리고 대상자의 무릎을 약간올려 무릎부위혈관에 압박이 가해지지 않도록 앉은 자세57semi ... 58high-fowler's position고파울러씨 체위침상머리부분을 90도 정도로 높여 앉는 자세로 호흡하도록 (좌위호흡,기좌호흡)을 하도록 하는 자세로 누운자세에서 호흡곤란
    Non-Ai HUMAN
    | 시험자료 | 12페이지 | 2,000원 | 등록일 2022.05.05
  • 판매자 표지 자료 표지
    Vital sign 정리
    Vital sign리포트간호학과vital sign(활력증후)1.체온(Body Temperature : BT)목적 - ①심부체온이 정상인지 파악하기 위해②특정치료에 대한 반응 ... 환경적 조건과 육체적 활동에도 불구하고 일정하게 유지되는 두개강, 흉강, 복강내의 온도를 의미표면온도(surface temperature) : 피부혈액의 흐름과 열소실량에 따라 ... 변화되는 온도시상하부(hyperthalamus)에 있는 체온조절 중추로 체온유지 : 기준점(set point)수행1. 준비 - 활력징후에 사용할 모든 기구들의 기능이 정삭적인지 확인
    Non-Ai HUMAN
    | 리포트 | 12페이지 | 4,000원 | 등록일 2022.04.22 | 수정일 2022.06.26
  • 판매자 표지 자료 표지
    국민대학교 동역학 중간고사 족보 및 답안
    .답 :힘의 3요소는 크기, 방향, 작용점이며 힘의 종류는 체적력(body force)과 표면력(surface forec)이 있고 체적력에는 중력, 자력등이 있고 표면력은 전단력 ... (order),몇 차(degree)인지를 답하시오.①y ' + (xy - cos x ) = 0 : 1계, 1차②L { d sup 2 Q } over { dt sup 2 } + B { dQ ... } over { dv sup 3 } right ) sup 2 - left ( { d sup 2 w } over { d v sup 2 } right ) sup 4 + vw =0: 3계
    시험자료 | 21페이지 | 3,000원 | 등록일 2023.09.16
  • (A+)성균관대학교-기계공학부-고체역학설계실습-Metallurgical microscope test
    lassifiare formed, it has an unusual layered structure. As the temperature gradually decreases on the γ ... a Fe-BCC structure (body-centered cubic structure). The spacing between Fe and Fe atoms is 0.35Å and ... Metallurgical microscope Test-Final Report-Method of observing metal’s microstructureClass number
    Non-Ai HUMAN
    | 리포트 | 14페이지 | 1,500원 | 등록일 2020.12.26
  • 의학용어 정리 파일, 물리치료학과, 간호학과, 방사선학과
    a particular region of the body7.surface anatomy (표면 해부학)focuses on superficial anatomic markings ... imilar cells performing common functions25.epithelial tissuecovers exposed surfaces and lines body c ... body temperature, houses cutaneous receptors, synthesizes vitamin D, prevents water loss30.Skeletal
    Non-Ai HUMAN
    | 리포트 | 4페이지 | 3,000원 | 등록일 2019.09.06 | 수정일 2024.07.19
  • [성인간호학 실습]신경외과(NS)병동 관련 의학용어 정리자료입니다.
    .water(aqua)물BBbed bath침상목욕BBTbasal body temperature기초체온BCback care등간호BDbirth date출생일BIDbrought of ... death사망한 채로 들어옴BILbilateral양측bldgbleeding출혈BSbefore sleep취침전BSAbody surface area체표면적BTbed time취침시간BWBody ... LMNLower motor neuron하부운동신경원LOCLevel of consciousness의식 수준MIDMulti-infarct dementia다발경화성 치매MSMultiple sc
    Non-Ai HUMAN
    | 리포트 | 4페이지 | 1,000원 | 등록일 2020.12.20 | 수정일 2021.01.04
해캠 AI 챗봇과 대화하기
챗봇으로 간편하게 상담해보세요.
2026년 04월 03일 금요일
AI 챗봇
안녕하세요. 해피캠퍼스 AI 챗봇입니다. 무엇이 궁금하신가요?
11:54 오전
문서 초안을 생성해주는 EasyAI
안녕하세요 해피캠퍼스의 20년의 운영 노하우를 이용하여 당신만의 초안을 만들어주는 EasyAI 입니다.
저는 아래와 같이 작업을 도와드립니다.
- 주제만 입력하면 AI가 방대한 정보를 재가공하여, 최적의 목차와 내용을 자동으로 만들어 드립니다.
- 장문의 콘텐츠를 쉽고 빠르게 작성해 드립니다.
- 스토어에서 무료 이용권를 계정별로 1회 발급 받을 수 있습니다. 지금 바로 체험해 보세요!
이런 주제들을 입력해 보세요.
- 유아에게 적합한 문학작품의 기준과 특성
- 한국인의 가치관 중에서 정신적 가치관을 이루는 것들을 문화적 문법으로 정리하고, 현대한국사회에서 일어나는 사건과 사고를 비교하여 자신의 의견으로 기술하세요
- 작별인사 독후감