[아미노산] 아미노산

등록일 2003.07.28 한글 (hwp) | 10페이지 | 가격 1,000원




단백질은 거대하고 복합한 분자이다. 이 중합체는 20 종이상의 서로다른 아미노산으로 구성되어 있는데, 아미노산의 중합체를 폴리펩티드(polypeptide)라고 한다.

폴리펩티드의 분자량은 몇 천에서 몇 백만 달톤에 까지 이른다.
보통 50개 이하의 아미노산으로 결합된 물질을 펩티드라고 한다.
펩티드와 단백질의 경계는 뚜렷하지 않으나 단백질은 보통 한 개 이상의 폴리펩티드로 구성되어 있다.

2개 또는 3개의 중합체를 올리고 펩티드라고 하고 10개 이상의 중합체를 폴리펩티드라 하며 단백질은 10,000 dalton 이상의 분자를 가진 아미노산의 중합체를 의미한다. 단백질과 폴리펩티드라는 용어는 가끔 혼용하여 사용하고 있다.

참고 자료

1. Mary K.Campbell, Shawn O.Farrell 지음
김재호, 장혜영 번역 , '생화학' 제 4판, 학술정보사, pp378 ~ 380
2. 박인국, '생화학', 라이프사이언스, pp56 ~ 57
3. 한국분자생물학회, '분자 생물학', 아카데미서적, pp506 ~ 507
4. 김경민, 서영훈, 신주옥, 이혜영, 정인실, 조은희, 하영미
'미생물학 제5판', 라이프 사이언스, pp291 ~ 294
5. Robert F. Weaver, 박상대, '분자 생물학', 라이프 사이언스, pp63 ~ 68
*원하는 자료를 검색 해 보세요.
  • 아미노산의 모든 것 25 페이지
    아미노산의 정의 아미노산(amino acids)은 자연 속에서는 약 100 여개 존재하는 것으로 알려져 있으나, 포유동물에서는 20개가 공통으로 발견되고 있다. ?아미노산들이 펩티드 결합(peptide bond)을 통해 특..
  • 아미노산의 특성에 따른 분류(필수 아미노산, 비필수 아미노산, 산성 염기성 중성 아미노산) 2 페이지
    ●아미노산 아미노산은 탄수화물과 지질처럼 신체의 에너지를 제공한다. 탄수화물과 지질이 기본적으로 C, H, O 3원소로 구성되어 있는 것에 비해 아미노산은 이들 3원소에 질소가 포함되어 질소의 급원이 된다는 차이점이 있다. ..
  • DNP 아미노산의 합성 4 페이지
    실험제목 : DNP-아미노산의 합성 실험 일시 : 12월 2일 시약 및 기구 1. 아미노산 - 글리신 2. NaHCO3 3. 1-플루오르-2,4-다이니트로벤젠 4. 에탄올 5. 에테르 6..
  • 단백질 2차구조 결정 결과 3 페이지
    1. 유사 Sequence비교 -> 제시된 아미노산 서열(1 letter code) : RIPKCRKEFQQAQHLRACQQWLHKQANQSGGGPS 유사한 단백질 : 1SM7, 1PNB 1. 1SM7 Amino..
  • [생화학]아미노산의 대사 31 페이지
    단백질은 아미노산이 peptide 결합으로 연결된 polypeptide이므로 위와 소장에서 가수분해되어 아미노산으로 된 다음 체내에 흡수된다. 흡수된 아미노산은 purine이나 pyrimidine 등의 핵산염기나 heme 그리..

이 자료와 함께 구매한 자료

      최근 구매한 회원 학교정보 보기
      1. 최근 2주간 다운받은 회원수와 학교정보이며
         구매한 본인의 구매정보도 함께 표시됩니다.
      2. 매시 정각마다 업데이트 됩니다. (02:00 ~ 21:00)
      3. 구매자의 학교정보가 없는 경우 기타로 표시됩니다.
      최근 본 자료더보기