
등록일 2002.12.06 한글 (hwp) | 3페이지 | 가격 800원


1. 실험 목적
2. 실험 이론
3. 결과 및 토의
4. 참고


1. 실험 목적
아미노산 중에 선택적인 구조의 경향성이 가장 큰 차이를 보이는 글루탐산(GLU)과 발린(VAL)을 이용하여 경향성을 알아본다.
2. 실험 이론
- 아미노산 : 한 분자 안에 아미노기와 카르복시기를 가지는 유기화합물. 단백질을 완전히 가수분해하면 암모니아와 유리 아미노산이 생성되는데, 아미노산은 모든 생명현상을 관장하고 있는 단백질의 기본 구성단위이다. 단백질에서 분리된 아미노산은 대개 아미노기와 카르복시기가 같은 탄소원자에 결합하여 R-CHNH2-COOH의 일반식으로 나타낼 수 있는 α-아미노산이다(R는 지방족 ·방향족 ·헤테로 고리의 치환기를 나타낸다). 이 밖에 아미노기가 차례로 이웃하는 탄소원자로 옮겨감에 따라 β-아미노산 ·膨-아미노산 ·δ-아미노산 등으로 부른다. 흔히 아미노산이라고 하면 α-아미노산을 가리킨다. 아미노산은 글리신을 제외하고 일반적으로 광학이성질체를 가지는데, 단백질 속에 있는 모든 아미노산은 α-탄소에 관하여 카르복시기와 아미노기의 배치 관계가 같고 L형이다. 그러나 D-아미노산도 또한 천연으로 존재하며, 미생물의 세포벽에 많이 함유되어 있다. D-아미노산을 함유하는 펩티드는 강한 항균작용(抗菌作用) 또는 독성을 보이는 것이 많은데, 그라미시딘이나 바시트라신 같은 폴리펩티드성 항생물질은 그 한 예이다.
*원하는 자료를 검색 해 보세요.
  • 단백질 2차구조 결정 결과 3페이지
    1. 유사 Sequence비교 -> 제시된 아미노산 서열(1 letter code) : RIPKCRKEFQQAQHLRACQQWLHKQANQSGGGPS 유사한 단백질 : 1SM7, 1PNB 1. 1SM7 Amino..
  • 아미노산에 대해서 5페이지
    1.아미노산이란? 아미노산(amino acid)은 생물의 몸을 구성하는 단백질의 기본 구성단위이다. 단백질을 완전히 가수분해하면 암모니아와 아미노산이 생성되는데, 아미노산은 아미노기와 카복시기를 포함한 모든 분자를 지칭한다..
  • 20가지 아미노산 구조 1페이지
    구조모형으로 나와있습니다
  • [생화학]아미노산의 정의와 구조 32페이지
    개괄(아미노산이 무엇인가?) ☞ 한 분자 안에 아미노기와 카르복시기를 가지는 유기화합물을 일컽는다. ☞ 아미노산은 모든 생명현상을 관장하고 있는 단백질의 기본 구성단위이다. (아미노..
  • 성질에 따른 아미노산의 분류 4페이지
    ●아미노산의 종류와 특징 아미노산의 종류는 20가지이며 아미노산의 R기의 기준에 따라 극성인가 비극성인가 그리고 산성 혹은 염기성인가에 따라 4가지 종류로 구분 지을 수 있다. GROUP.1 ○비극성(소수성) R..
      최근 구매한 회원 학교정보 보기
      1. 최근 2주간 다운받은 회원수와 학교정보이며
         구매한 본인의 구매정보도 함께 표시됩니다.
      2. 매시 정각마다 업데이트 됩니다. (02:00 ~ 21:00)
      3. 구매자의 학교정보가 없는 경우 기타로 표시됩니다.
      4. 지식포인트 보유 시 지식포인트가 차감되며
         미보유 시 아이디당 1일 3회만 제공됩니다.
      최근 본 자료더보기
      상세우측 배너