20가지 아미노산 구조

등록일 2002.05.30 한글 (hwp) | 1페이지 | 가격 1,000원

목차

없음

본문내용

구조모형으로 나와있습니다
*원하는 자료를 검색 해 보세요.
  • 단백질 2차구조 결정 결과 3 페이지
    1. 유사 Sequence비교 -> 제시된 아미노산 서열(1 letter code) : RIPKCRKEFQQAQHLRACQQWLHKQANQSGGGPS 유사한 단백질 : 1SM7, 1PNB 1. 1SM7 Amino..
  • 아미노산에 대해서 5 페이지
    1.아미노산이란? 아미노산(amino acid)은 생물의 몸을 구성하는 단백질의 기본 구성단위이다. 단백질을 완전히 가수분해하면 암모니아와 아미노산이 생성되는데, 아미노산은 아미노기와 카복시기를 포함한 모든 분자를 지칭한다..
  • [생화학]아미노산의 정의와 구조 32 페이지
    개괄(아미노산이 무엇인가?) ☞ 한 분자 안에 아미노기와 카르복시기를 가지는 유기화합물을 일컽는다. ☞ 아미노산은 모든 생명현상을 관장하고 있는 단백질의 기본 구성단위이다. (아미노..
  • 성질에 따른 아미노산의 분류 4 페이지
    ●아미노산의 종류와 특징 아미노산의 종류는 20가지이며 아미노산의 R기의 기준에 따라 극성인가 비극성인가 그리고 산성 혹은 염기성인가에 따라 4가지 종류로 구분 지을 수 있다. GROUP.1 ○비극성(소수성) R..
  • 21세기 영양학 단백질 연습문제 6 페이지
    1. 필수 아미노산을 정의하고 건강상의 중요성을 설명하라. 단백질은 20여 종의 아미노산으로 구성되어있다. 이들 아미노산은 서로 다른 화학적 구조이며, 양적으로도 차이가 많다. 아미노산은 비필수 아미노산과 필수 아미노산으..
      최근 구매한 회원 학교정보 보기
      1. 최근 2주간 다운받은 회원수와 학교정보이며
         구매한 본인의 구매정보도 함께 표시됩니다.
      2. 매시 정각마다 업데이트 됩니다. (02:00 ~ 21:00)
      3. 구매자의 학교정보가 없는 경우 기타로 표시됩니다.
      최근 본 자료더보기