[생화학 실험] Dipeptide의 아미노산 서열 결정

등록일 2002.03.09 한글 (hwp) | 8페이지 | 가격 800원


1. 실험제목
2. 실험일자
3. 제출자
4. 목적
5. 원리
6. 시약 및 기자재
7. 방법
8. 결과
9. 고찰
10. 참고문헌
11. 숙제


4. 목적
dipeptide 가수분해를 통해 dipeptide의 아미노산서열을 결정해본다. FDNB가 dipeptide의 α-amino group을 nucleophilical attack에 의해 N-terminal derivative를 만들어낸다. 이것을 산성에서 가수분해하여 ether로 extraction을 거치면 ether phase(N-terminal DNP amino acid, diDNP-amino acid)와 aqueous phase( charged amino group)으로 분리된다. 그런 다음 paper chromatography와 TLC를 통해 두가지 아미노산의 서열을 알 수 있다.

참고 자료

생화학 실험 매뉴얼 4장
출전:화학 사전(탐구당 편)
*원하는 자료를 검색 해 보세요.
  • Dipeptide의 아미노산 서열 결정 11페이지
    종이 크로마토그래피(Paper Chromatography: PC)는 엄밀히 말하면 PC는 흡착과 분배 크로마토그래피가 혼합된 것이다. PC에서 용질은 셀룰로오스의 수화된 물과 유기 상 사이에서 분배되므로 극성이 크거나 여러 작..
  • [생화학] Dipeptide의 아미노산 서열 결정 8페이지
    9.고찰 2주간에 걸친 긴 실험이었다. 결과를 빨리 볼 수는 없었지만 수업시간에 배운 내용들을 확인할 수 있는 실험이어서 상당히 효과적인 실험이었다. 첫 주에는 일주일 뒤에 실험을 하는데 필요한 시료를 만들고 그 일주일 ..
  • 단백질 2차구조 결정 결과 3페이지
    1. 유사 Sequence비교 -> 제시된 아미노산 서열(1 letter code) : RIPKCRKEFQQAQHLRACQQWLHKQANQSGGGPS 유사한 단백질 : 1SM7, 1PNB 1. 1SM7 Amino..
  • 염기 서열 분석 문제 2페이지
    Question Deduce the sequence of amino acids in this polypeptide from the following information: 1)Complete acid hydroly..
  • 유전자 발현 DNA→RNA→단백질 전사-DNA 정보가 mRNA로 12페이지
    유전자 발현 전사 → 스플라이싱 → 번역 → 입체구조화 DNA 염기서열과 아미노산 서열은 평행하다 헤모글로빈을 구성하는 한 가닥 사슬의 처음7개 아미노산을 암호화 하는 염기서열 T가 A로 돌연변이→글루탐산이 발린..
      최근 구매한 회원 학교정보 보기
      1. 최근 2주간 다운받은 회원수와 학교정보이며
         구매한 본인의 구매정보도 함께 표시됩니다.
      2. 매시 정각마다 업데이트 됩니다. (02:00 ~ 21:00)
      3. 구매자의 학교정보가 없는 경우 기타로 표시됩니다.
      4. 지식포인트 보유 시 지식포인트가 차감되며
         미보유 시 아이디당 1일 3회만 제공됩니다.
      상세하단 배너
      최근 본 자료더보기
      상세우측 배너
      [생화학 실험] Dipeptide의 아미노산 서열 결정